Metadata-Version: 2.1
Name: gt4sd
Version: 0.26.0
Summary: Generative Toolkit for Scientific Discovery (GT4SD).
Home-page: UNKNOWN
Author: GT4SD team
License: UNKNOWN
Description: # GT4SD (Generative Toolkit for Scientific Discovery)
        
        [![PyPI version](https://badge.fury.io/py/gt4sd.svg)](https://badge.fury.io/py/gt4sd)
        [![Actions tests](https://github.com/gt4sd/gt4sd-core/actions/workflows/tests.yaml/badge.svg)](https://github.com/gt4sd/gt4sd-core/actions)
        [![License: MIT](https://img.shields.io/badge/License-MIT-yellow.svg)](https://opensource.org/licenses/MIT)
        [![Code style: black](https://img.shields.io/badge/code%20style-black-000000.svg)](https://github.com/psf/black)
        [![Contributions](https://img.shields.io/badge/contributions-welcome-blue)](https://github.com/GT4SD/gt4sd-core/blob/main/CONTRIBUTING.md)
        [![Docs](https://img.shields.io/badge/website-live-brightgreen)](https://gt4sd.github.io/gt4sd-core/)
        [![Total downloads](https://pepy.tech/badge/gt4sd)](https://pepy.tech/project/gt4sd)
        [![Monthly downloads](https://pepy.tech/badge/gt4sd/month)](https://pepy.tech/project/gt4sd)
        
        <img src="./docs/_static/gt4sd_logo.png" alt="logo" width="500"/>
        
        The GT4SD (Generative Toolkit for Scientific Discovery) is an open-source platform to accelerate hypothesis generation in the scientific discovery process. It provides a library for making state-of-the-art generative AI models easier to use.
        
        For full details on the library API and examples see the [docs](https://gt4sd.github.io/gt4sd-core/).
        
        ## Installation
        
        ### requirements
        
        Currently `gt4sd` relies on:
        
        - python>=3.7,<3.8
        - pip>=19.1,<20.3
        
        We are actively working on relaxing these, so stay tuned or help us with this by [contributing](./CONTRIBUTING.md) to the project.
        
        ### conda
        
        The recommended way to install the `gt4sd` is to create a dedicated conda environment, this will ensure all requirements are satisfied:
        
        ```sh
        conda env create -f conda.yml
        conda activate gt4sd
        ```
        
        And install the package via `pip` from [PyPI](https://pypi.org/project/gt4sd/):
        
        ```sh
        pip install gt4sd
        ```
        
        **NOTE:** In case you want to reuse an existing compatible environment (see [requirements](#requirements)), you can use `pip`, but as of now (:eyes: on [issue](https://github.com/GT4SD/gt4sd-core/issues/31) for changes), some dependencies require installation from GitHub, so for a complete setup install them with:
        
        ```sh
        pip install -r vcs_requirements.txt
        ```
        
        ### Development setup & installation
        
        If you would like to contribute to the package, we recommend the following development setup:
        
        ```sh
        conda env create -f conda.yml
        conda activate gt4sd
        # install gt4sd in editable mode
        pip install --no-deps -e .
        ```
        
        Learn more in [CONTRIBUTING.md](./CONTRIBUTING.md)
        
        ## Getting started
        
        After install you can use `gt4sd` right away in your discovery workflows.
        
        ### Running inference pipelines in your python code
        
        Running an algorithm is as easy as typing:
        
        ```python
        from gt4sd.algorithms.conditional_generation.paccmann_rl.core import (
            PaccMannRLProteinBasedGenerator, PaccMannRL
        )
        target = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT'
        # algorithm configuration with default parameters
        configuration = PaccMannRLProteinBasedGenerator()
        # instantiate the algorithm for sampling
        algorithm = PaccMannRL(configuration=configuration, target=target)
        items = list(algorithm.sample(10))
        print(items)
        ```
        
        Or you can use the `ApplicationRegistry` to run an algorithm instance using a serialized representation of the algorithm:
        
        ```python
        from gt4sd.algorithms.registry import ApplicationsRegistry
        target = 'MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT'
        algorithm = ApplicationsRegistry.get_application_instance(
            target=target,
            algorithm_type='conditional_generation',
            domain='materials',
            algorithm_name='PaccMannRL',
            algorithm_application='PaccMannRLProteinBasedGenerator',
            generated_length=32,
            # include additional configuration parameters as **kwargs
        )
        items = list(algorithm.sample(10))
        print(items)
        ```
        
        ### Running inference pipelines via the CLI command
        
        GT4SD can run inference pipelines based on the `gt4sd-inference` CLI command.
        It allows to run all inference algorithms directly from the command line.
        
        You can run inference pipelines simply typing:
        
        ```console
        gt4sd-inference --algorithm_name PaccMannRL --algorithm_application PaccMannRLProteinBasedGenerator --target MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTT --number_of_samples 10
        ```
        
        The command supports multiple parameters to select an algorithm and configure it for inference:
        
        ```console
        $ gt4sd-inference --help
        usage: gt4sd-inference [-h] [--algorithm_type ALGORITHM_TYPE]
                               [--domain DOMAIN] [--algorithm_name ALGORITHM_NAME]
                               [--algorithm_application ALGORITHM_APPLICATION]
                               [--algorithm_version ALGORITHM_VERSION]
                               [--target TARGET]
                               [--number_of_samples NUMBER_OF_SAMPLES]
                               [--configuration_file CONFIGURATION_FILE]
                               [--print_info [PRINT_INFO]]
        
        optional arguments:
          -h, --help            show this help message and exit
          --algorithm_type ALGORITHM_TYPE
                                Inference algorithm type, supported types:
                                conditional_generation, controlled_sampling,
                                generation, prediction. (default: None)
          --domain DOMAIN       Domain of the inference algorithm, supported types:
                                materials, nlp. (default: None)
          --algorithm_name ALGORITHM_NAME
                                Inference algorithm name. (default: None)
          --algorithm_application ALGORITHM_APPLICATION
                                Inference algorithm application. (default: None)
          --algorithm_version ALGORITHM_VERSION
                                Inference algorithm version. (default: None)
          --target TARGET       Optional target for generation represented as a
                                string. Defaults to None, it can be also provided in
                                the configuration_file as an object, but the
                                commandline takes precendence. (default: None)
          --number_of_samples NUMBER_OF_SAMPLES
                                Number of generated samples, defaults to 5. (default:
                                5)
          --configuration_file CONFIGURATION_FILE
                                Configuration file for the inference pipeline in JSON
                                format. (default: None)
          --print_info [PRINT_INFO]
                                Print info for the selected algorithm, preventing
                                inference run. Defaults to False. (default: False)
        ```
        
        You can use `gt4sd-inference` to directly get information on the configuration parameters for the selected algorithm:
        
        ```console
        gt4sd-inference --algorithm_name PaccMannRL --algorithm_application PaccMannRLProteinBasedGenerator --print_info
        INFO:gt4sd.cli.inference:Selected algorithm: {'algorithm_type': 'conditional_generation', 'domain': 'materials', 'algorithm_name': 'PaccMannRL', 'algorithm_application': 'PaccMannRLProteinBasedGenerator', 'algorithm_version': 'v0'}
        INFO:gt4sd.cli.inference:Selected algorithm support the following configuration parameters:
        {
         "batch_size": {
          "description": "Batch size used for the generative model sampling.",
          "title": "Batch Size",
          "default": 32,
          "type": "integer",
          "optional": true
         },
         "temperature": {
          "description": "Temperature parameter for the softmax sampling in decoding.",
          "title": "Temperature",
          "default": 1.4,
          "type": "number",
          "optional": true
         },
         "generated_length": {
          "description": "Maximum length in tokens of the generated molcules (relates to the SMILES length).",
          "title": "Generated Length",
          "default": 100,
          "type": "integer",
          "optional": true
         }
        }
        Target information:
        {
         "target": {
          "title": "Target protein sequence",
          "description": "AA sequence of the protein target to generate non-toxic ligands against.",
          "type": "string"
         }
        }
        ```
        
        ### Running training pipelines via the CLI command
        
        GT4SD provides a trainer client based on the `gt4sd-trainer` CLI command. The trainer currently supports training pipelines for language modeling (`language-modeling-trainer`), PaccMann (`paccmann-vae-trainer`) and Granular (`granular-trainer`, multimodal compositional autoencoders).
        
        ```console
        $ gt4sd-trainer --help
        usage: gt4sd-trainer [-h] --training_pipeline_name TRAINING_PIPELINE_NAME
                             [--configuration_file CONFIGURATION_FILE]
        
        optional arguments:
          -h, --help            show this help message and exit
          --training_pipeline_name TRAINING_PIPELINE_NAME
                                Training type of the converted model, supported types:
                                granular-trainer, language-modeling-trainer, paccmann-
                                vae-trainer. (default: None)
          --configuration_file CONFIGURATION_FILE
                                Configuration file for the trainining. It can be used
                                to completely by-pass pipeline specific arguments.
                                (default: None)
        ```
        
        To launch a training you have two options.
        
        You can either specify the training pipeline and the path of a configuration file that contains the needed training parameters:
        
        ```sh
        gt4sd-trainer  --training_pipeline_name ${TRAINING_PIPELINE_NAME} --configuration_file ${CONFIGURATION_FILE}
        ```
        
        Or you can provide directly the needed parameters as arguments:
        
        ```sh
        gt4sd-trainer  --training_pipeline_name language-modeling-trainer --type mlm --model_name_or_path mlm --training_file /pah/to/train_file.jsonl --validation_file /path/to/valid_file.jsonl 
        ```
        
        To get more info on a specific training pipeleins argument simply type:
        
        ```sh
        gt4sd-trainer --training_pipeline_name ${TRAINING_PIPELINE_NAME} --help
        ```
        
        ### Saving a trained algorithm for inference via the CLI command
        
        Once a training pipeline has been run via the `gt4sd-trainer`, it's possible to save the trained algorithm via `gt4sd-saving` for usage in compatible inference pipelines.
        
        Here a small example for `PaccmannGP` algorithm ([paper](https://doi.org/10.1021/acs.jcim.1c00889)).
        
        You can train a model with `gt4sd-trainer` (quick training using few data, not really recommended for a realistic model :warning:):
        
        ```sh
        gt4sd-trainer  --training_pipeline_name paccmann-vae-trainer --epochs 250 --batch_size 4 --n_layers 1 --rnn_cell_size 16 --latent_dim 16 --train_smiles_filepath src/gt4sd/training_pipelines/tests/molecules.smi --test_smiles_filepath src/gt4sd/training_pipelines/tests/molecules.smi --model_path /tmp/gt4sd-paccmann-gp/ --training_name fast-example --eval_interval 15 --save_interval 15 --selfies
        ```
        
        Save the model with the compatible inference pipeline using `gt4sd-saving`:
        
        ```sh
        gt4sd-saving --training_pipeline_name paccmann-vae-trainer --model_path /tmp/gt4sd-paccmann-gp/ --training_name fast-example --target_version fast-example-v0 --algorithm_application PaccMannGPGenerator
        ```
        
        Run the algorithm via `gt4sd-inference` (again the model produced in the example is trained on dummy data and will give dummy outputs, do not use it as is :no_good:):
        
        ```sh
        gt4sd-inference --algorithm_name PaccMannGP --algorithm_application PaccMannGPGenerator --algorithm_version fast-example-v0 --number_of_samples 5  --target '{"molwt": {"target": 60.0}}'
        ```
        
        ### Additional examples
        
        Find more examples in [notebooks](./notebooks)
        
        <!-- Having a list of all supported algorithms wouldn be nice! -->
        
        ## Supported packages
        
        Beyond implementing various generative modeling inference and training pipelines GT4SD is designed to provide a high-level API that implement an harmonized interface for several existing packages:
        
        - [GuacaMol](https://github.com/BenevolentAI/guacamol): inference pipelines for the baselines models.
        - [MOSES](https://github.com/molecularsets/moses): inference pipelines for the baselines models.
        - [TAPE](https://github.com/songlab-cal/tape): encoder modules compatible with the protein language models.
        - [PaccMann](https://github.com/PaccMann/): inference pipelines for all algorithms of the PaccMann family as well as traiing pipelines for the generative VAEs.
        - [transformers](https://huggingface.co/transformers): training and inference pipelines for generative models from the [HuggingFace Models](https://huggingface.co/models)
        
        ## References
        
        If you use `gt4sd` in your projects, please consider citing the following:
        
        ```bib
        @software{GT4SD,
        author = {GT4SD Team},
        month = {2},
        title = {{GT4SD (Generative Toolkit for Scientific Discovery)}},
        url = {https://github.com/GT4SD/gt4sd-core},
        version = {main},
        year = {2022}
        }
        ```
        
        ## License
        
        The `gt4sd` codebase is under MIT license.
        For individual model usage, please refer to the model licenses found in the original packages.
        
Keywords: GT4SD Generative Models Inference Training
Platform: UNKNOWN
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: 3.7
Description-Content-Type: text/markdown
Provides-Extra: extras
